Learn More
Invitrogen™ Human TdT (aa 356-440) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108819
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Terminal Deoxynucleotidyl Transferase (TdT) is a DNA polymerase located in the cell nucleus which catalyses the polymerization of deoxynucleotides at the 3' hydroxyl ends of oligo or polydeoxynucleotide initiators and functions without a template. TdT is considered to be a highly specific marker for the diagnosis and classification of acute lymphoblastic lymphoma/leuksemias. The determination of TdT expression is most valuable when it is different to differentiate histologically between lymphoblastic lymphoma and Burkitt's lymphoma.
Especificaciones
P04053 | |
Blocking Assay, Control | |
1791 | |
100 μL | |
Deoxynucleotidyltransferase terminal; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; Dntt; Nucleosidetriphosphate DNA Deoxynucleotidylexotransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase; TDT; Terminal addition enzyme; terminal deoxynucleotidyl transferase; terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; terminal transferase | |
DNTT | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TdT (aa 356-440) Control Fragment | |
RUO | |
TdT | |
Unconjugated | |
Recombinant | |
DEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSSWQEGKTWKAIRVDLVLCPYE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.