missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Syncollin Control Fragment Recombinant Protein Código de producto.: 30181514

Invitrogen™ Human Syncollin Control Fragment Recombinant Protein

Código de producto. 30181514
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30181514

Marca: Invitrogen™ RP99213

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61563 (PA5-61563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Syncollin is a 134 amino acid, small peripheral membrane protein abundantly expressed in pancreatic acinar cells and is tightly associated with the lumenal side of the zymogen granule membrane. It contains intrachain disulfide bonds. Syncollin is also known to associate with lipid rafts in a cholesterol-dependent manner. In pancreatic acinar cells, syncollin helps in exocytosis and also plays a role in maturation and/or concentration of zymogens in zymogen granules. Reports suggest that syncollin may also have a pore-forming activity on membranes and regulate exocytosis insome exocrine tissues.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q0VAF6
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 342898
Nombre Human Syncollin Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 0910001K16Rik; 1810038B08Rik; FLJ27441; INSSA1; insulin synthesis associated 1; insulin synthesis-associated protein 1; Proximal small intestine-specific protein 9; Sip9; Sycn; SYL; syncollin
Nombre común Syncollin
Símbolo de gen SYCN
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human Syncollin Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado