Learn More
Invitrogen™ Human Syncollin Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP99213
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61563 (PA5-61563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Syncollin is a 134 amino acid, small peripheral membrane protein abundantly expressed in pancreatic acinar cells and is tightly associated with the lumenal side of the zymogen granule membrane. It contains intrachain disulfide bonds. Syncollin is also known to associate with lipid rafts in a cholesterol-dependent manner. In pancreatic acinar cells, syncollin helps in exocytosis and also plays a role in maturation and/or concentration of zymogens in zymogen granules. Reports suggest that syncollin may also have a pore-forming activity on membranes and regulate exocytosis insome exocrine tissues.
Especificaciones
Q0VAF6 | |
Blocking Assay, Control | |
342898 | |
100 μL | |
0910001K16Rik; 1810038B08Rik; FLJ27441; INSSA1; insulin synthesis associated 1; insulin synthesis-associated protein 1; Proximal small intestine-specific protein 9; Sip9; Sycn; SYL; syncollin | |
SYCN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Syncollin Control Fragment | |
RUO | |
Syncollin | |
Unconjugated | |
Recombinant | |
TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.