Learn More
Invitrogen™ Human STAC3 (aa 105-180) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP105960
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65228 (PA5-65228. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The Src homology 3 (SH3) domain is a highly conserved 60 amino acid protein domain that is organized into a beta-barrel fold consisting of five or six beta strands arranged as two tightly packed anti-parallel beta sheets. This domain is found in proteins that mediate assembly of specific protein complexes and interact with other proteins, specifically recognizing proline-rich regions. STAC3 (SH3 and cysteine rich domain 3) is a 364 amino acid protein containing one phorbol-ester/DAG-type zinc finger and two SH3 (Src homology 3) domains. Existing as two alternatively spliced isoforms, STAC3 maps to human chromosome 12q13.3. Human chromosome 12 encodes over 1,400 genes and comprises approximately 4.5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and trisomy 12p, which causes facial developmental defects and seizure disorders.
Especificaciones
Q96MF2 | |
Blocking Assay, Control | |
246329 | |
100 μL | |
9830125E18; NAM; SH3 and cysteine rich domain 3; SH3 and cysteine-rich domain-containing protein 3; STAC3 | |
Stac3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human STAC3 (aa 105-180) Control Fragment | |
RUO | |
STAC3 | |
Unconjugated | |
Recombinant | |
VCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPVFET | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.