missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ST8SIA1 Partial ORF (NP_003025, 61 a.a. - 160 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Cantidad:
10 ug
25 ug
Tamaño de la unidad:
10 microgramos
25 microgramos
Descripción
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. [provided by RefSeq]
Sequence: VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEAN
Especificaciones
Especificaciones
| Número de acceso | NP_003025 |
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 6489 |
| Peso molecular | 36.74kDa |
| Nombre | ST8SIA1 (Human) Recombinant Protein (Q01) |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Cantidad | 10 ug |
| Inmunógeno | VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEAN |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human ST8SIA1 Partial ORF (NP_003025, 61 a.a. - 160 a.a.) Recombinant Protein with GST-tag at N-terminal >
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido