Learn More
Invitrogen™ Human ST3GAL5 (aa 236-333) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP105461
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67026 (PA5-67026. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene.
Especificaciones
Q9UNP4 | |
Blocking Assay, Control | |
8869 | |
100 μL | |
[a]2; 3 S-T; alpha 2,3-sialyltransferase V; alpha2,3-sialyltransferase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; Ganglioside GM3 synthase; GM3 synthase; GM3S; GM3-specific sialytransferase; lactosylceramide alpha-2,3-sialyltransferase; lactosylceramide alpha-2,3-sialyltransferas-like protein; mST3Gal V; SATI; Sialyltransferase 9; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase); sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase); Siat9; SIATGM3S; ST3 beta-galactoside alpha-2,3-sialyltransferase 5; ST3 beta-galactoside alpha-23-sialyltransferase 5; ST3Gal V; ST3GAL5; ST3GalV; ST3GAL-V; UNQ2510/PRO5998 | |
ST3GAL5 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ST3GAL5 (aa 236-333) Control Fragment | |
RUO | |
ST3GAL5 | |
Unconjugated | |
Recombinant | |
NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.