Learn More
Invitrogen™ Human SSBP1 (aa 7-146) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP102227
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51759 (PA5-51759. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication. SSBP is a housekeeping gene involved in mitochondrial biogenesis.
Especificaciones
Q04837 | |
Blocking Assay, Control | |
6742 | |
100 μL | |
2810480P10Rik; G630031O20Rik; mtDBP; mtSSB; Mt-SSB; PWP1-interacting protein 17; single strand DNA-binding protein P16; single stranded DNA binding protein 1; single-stranded DNA binding protein 1; single-stranded DNA binding protein 1, mitochondrial; single-stranded DNA-binding protein, mitochondrial; SOSS-B1; Ssbp; Ssbp1 | |
Ssbp1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SSBP1 (aa 7-146) Control Fragment | |
RUO | |
SSBP1 | |
Unconjugated | |
Recombinant | |
LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.