Learn More
Invitrogen™ Human SNIP (aa 831-916) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP103528
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64135 (PA5-64135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance.
Especificaciones
Q9C0H9 | |
Blocking Assay, Control | |
80725 | |
100 μL | |
KIAA1684; mKIAA1684; p130Cas-associated protein; P140; p140Cap; SNAP-25-interacting protein; SNAP25-interacting protein; SNIP; SRC kinase signaling inhibitor 1; SRCIN1 | |
SRCIN1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SNIP (aa 831-916) Control Fragment | |
RUO | |
SNIP | |
Unconjugated | |
Recombinant | |
EGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKRSVDKAVSVEAAERDWE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.