Learn More
Invitrogen™ Human SMAD9 (aa 118-261) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP102587
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily. SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, 2, 5, 8 and 9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and 7). SMAD1, 5, 8 and 9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used as alternate names for one another in the literature. Mutations of this gene can lead to pulmonary hypertension, primary 2 (PPH2).
Especificaciones
O15198 | |
Blocking Assay, Control | |
4093 | |
100 μL | |
HGNC:6774; MAD; MAD homolog 9; MADH6; Madh8; MADH9; Mothers against decapentaplegic homolog 9; Mothers against decapentaplegic, drosophila, homolog of, 9; mothers against DPP homolog 9; PPH2; RP11-421P11.9; SMAD; SMAD 9; SMAD family member 9; SMAD, mothers against DPP homolog 9; SMAD8; SMAD8/9; SMAD8A; SMAD8B; SMAD9 | |
SMAD9 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SMAD9 (aa 118-261) Control Fragment | |
RUO | |
SMAD9 | |
Unconjugated | |
Recombinant | |
GSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQSGQPVDATADRHVVLSIPNGD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.