missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human SLC38A1 (aa 5-70) Control Fragment Recombinant Protein Código de producto.: 30181721
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30181721

Invitrogen™ Human SLC38A1 (aa 5-70) Control Fragment Recombinant Protein

Código de producto. 30181721
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30181721

Marca: Invitrogen™ RP97695

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62580 (PA5-62580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9H2H9
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 81539
Nombre Human SLC38A1 (aa 5-70) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AA408026; AA409865; AL022800; Amino acid transporter A1; amino acid transporter system A1; ATA1; AU015942; GlnT; glutamine transporter; MNat2; Nat2; N-system amino acid transporter 2; rATA1; S38A1; Sa2; SAT1; SLC38A1; SNAT 1; Snat1; sodium-coupled neutral amino acid transporter 1; Solute carrier family 38 member 1; solute carrier family 38, member 1; system A amino acid transporter 1; System A transporter 2; system N amino acid transporter 1
Nombre común SLC38A1
Símbolo de gen SLC38A1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human SLC38A1 (aa 5-70) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado