missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SLC38A1 (aa 5-70) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP97695
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62580 (PA5-62580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
Especificaciones
| Q9H2H9 | |
| Blocking Assay, Control | |
| 81539 | |
| 100 μL | |
| AA408026; AA409865; AL022800; Amino acid transporter A1; amino acid transporter system A1; ATA1; AU015942; GlnT; glutamine transporter; MNat2; Nat2; N-system amino acid transporter 2; rATA1; S38A1; Sa2; SAT1; SLC38A1; SNAT 1; Snat1; sodium-coupled neutral amino acid transporter 1; Solute carrier family 38 member 1; solute carrier family 38, member 1; system A amino acid transporter 1; System A transporter 2; system N amino acid transporter 1 | |
| SLC38A1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SLC38A1 (aa 5-70) Control Fragment | |
| RUO | |
| SLC38A1 | |
| Unconjugated | |
| Recombinant | |
| KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human SLC38A1 (aa 5-70) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido