Learn More
Invitrogen™ Human SLC22A11 (aa 281-341) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP88589
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55285 (PA5-55285. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Especificaciones
Q9NSA0 | |
Blocking Assay, Control | |
55867 | |
100 μL | |
hOAT4; MGC34282; OAT4; Organic anion transporter 4; SLC22A11; solute carrier family 22 (organic anion/cation transporter), member 11; solute carrier family 22 (organic anion/urate transporter), member 11; solute carrier family 22 member 11 | |
SLC22A11 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SLC22A11 (aa 281-341) Control Fragment | |
RUO | |
SLC22A11 | |
Unconjugated | |
Recombinant | |
RWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.