missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC14A2 Partial ORF (NP_009094, 40 a.a. - 128 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Descripción
In mammalian cells, urea is the chief end-product of nitrogen catabolism and plays an important role in the urinary concentration mechanism. Thus, the plasma membrane of erythrocytes and some renal epithelial cells exhibit an elevated urea permeability that is mediated by highly selective urea transporters. In mammals, 2 urea transporters have been identified: the renal tubular urea transporter, UT2, and the erythrocyte urea transporter, UT11 (SLC14A1; MIM 111000).[supplied by OMIM]
Sequence: ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ
Especificaciones
Especificaciones
| Número de acceso | NP_009094 |
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 8170 |
| Peso molecular | 35.53kDa |
| Nombre | SLC14A2 (Human) Recombinant Protein (Q01) |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Cantidad | 25 μg |
| Inmunógeno | ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human SLC14A2 Partial ORF (NP_009094, 40 a.a. - 128 a.a.) Recombinant Protein with GST-tag at N-terminal >
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido