Learn More
Invitrogen™ Human SKAP2 (aa 13-151) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP88611
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54963 (PA5-54963. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Fyb (Fyn binding protein) and the anchoring proteins SKAP55 and SKAP55-R (SKAP55-related protein) associate with the tyrosine kinase p59fyn. SKAP55 and SKAP55-R bind to Fyb through their SH3 domains and function as substrates for p59Fyn in resting T cells. SKAP55 contains an N-terminal pleckstrin homology domain and a C-terminal SH3 domain binding motif of adjacent arginine and lysine residues followed by tandem tyrosines (i.e. RKxxYxxY). SKAP55-R, similar in overall structure to SKAP55, contains a coiled-coil N-terminal domain. SKAP55 associates with SLAP-130, another component of the Fyn complex, which plays a role in the regulation of signaling events initiated by lymphocyte antigen receptors leading up to T cell activation. The human SKAP55 gene maps to chromosome 17q21.32 and encodes a 359 amino acid protein.
Especificaciones
O75563 | |
Blocking Assay, Control | |
8935 | |
100 μL | |
2610021A10Rik; AA960083; BB137539; Fyn-associated phosphoprotein SKAP55 homologue; MGC10411; MGC33304; mSKAP55R; PRAP; pyk2/RAFTK-associated protein; RA70; Retinoic acid-induced protein 70; Saps; SCAP2; Scap55r; Skap2; SKAP55 homolog; SKAP55 homologue; SKAP-55 HOM; SKAP55-HOM; SKAP55R; SKAP-HOM; src family associated phosphoprotein 2; src family-associated phosphoprotein 2; src kinase associated phosphoprotein 2; src kinase-associated phosphoprotein 2; Src kinase-associated phosphoprotein 55-related protein; src kinase-associated phosphoprotein of 55-related protein; src-associated adapter protein with PH and SH3 domains; Src-associated adaptor protein | |
SKAP2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SKAP2 (aa 13-151) Control Fragment | |
RUO | |
SKAP2 | |
Unconjugated | |
Recombinant | |
LPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYY | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.