missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human SIPA1 (aa 884-984) Control Fragment Recombinant Protein Código de producto.: 30197821
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197821

Invitrogen™ Human SIPA1 (aa 884-984) Control Fragment Recombinant Protein

Código de producto. 30197821
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197821

Marca: Invitrogen™ RP97563

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58957 (PA5-58957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene is a mitogen induced GTPase activating protein. It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell cycle progression when abnormally or prematurely expressed. It is localized to the perinuclear region. Two alternatively spliced variants encoding the same isoform have been characterized to date.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96FS4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6494
Nombre Human SIPA1 (aa 884-984) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen GTPase-activating protein Spa-1; MGC102688; MGC17037; p130 SPA-1; signal-induced proliferation associated gene 1; signal-induced proliferation-associated 1; signal-induced proliferation-associated gene 1; signal-induced proliferation-associated protein 1; SIPA1; Sipa-1; SPA1
Nombre común SIPA1
Símbolo de gen SIPA1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SPSGSEDKGNPAPELRASFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESM
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human SIPA1 (aa 884-984) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado