missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SHIP2 (aa 94-180) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP96522
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83381 (PA5-83381. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is an SH2-containing 5'-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodeling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer.
Especificaciones
| O15357 | |
| Blocking Assay, Control | |
| 3636 | |
| 100 μL | |
| 51 C; 51 C protein; ablSH3-binding protein; inositol polyphosphate phosphatase like 1; inositol polyphosphate phosphatase-like 1; inositol polyphosphate phosphatase-like protein 1; Inppl1; INPPL-1; OPSMD; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2; protein 51 C; SH2 domain-containing inositol 5'-phosphatase 2; SH2 domain-containing inositol phosphatase 2; SH2 domain-containing inositol-5'-phosphatase 2; SH2-containing inositol phosphatase 2; SHIP2; SHIP-2 | |
| INPPL1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SHIP2 (aa 94-180) Control Fragment | |
| RUO | |
| SHIP2 | |
| Unconjugated | |
| Recombinant | |
| TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human SHIP2 (aa 94-180) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido