missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ Human SEC13 Full-length ORF (AAH02634.2, 1 a.a. - 325 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SEC13 Full-length ORF (AAH02634.2, 1 a.a. - 325 a.a.) Recombinant Protein with GST-tag at N-terminal

Código de producto. p-7096416
25 ug, 25 microgramos
Click to view available options
Cantidad:
10 ug
25 ug
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq]

Sequence: MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ

Especificaciones

Número de acceso AAH02634.2
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 6396
Peso molecular 62.3kDa
Nombre SEC13 (Human) Recombinant Protein (P01)
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 25 ug
Inmunógeno MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Alias de gen D3S1231E/SEC13L1/SEC13R/npp-20
Nombre común SEC13
Símbolo de gen SEC13
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Sistema de expresión wheat germ expression system
Formulario Liquid
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Abnova™ Human SEC13 Full-length ORF (AAH02634.2, 1 a.a. - 325 a.a.) Recombinant Protein with GST-tag at N-terminal >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado