Learn More
Invitrogen™ Human RRBP1 (aa 1055-1178) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90187
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82444 (PA5-82444. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized. RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome. Alternate splicing results in multiple transcript variants.
Especificaciones
Q9P2E9 | |
Blocking Assay, Control | |
6238 | |
100 μL | |
1700087N07Rik; 180 kDa ribosome receptor homolog; 5730465C04Rik; ES/130; ES/130-related protein; ES130; hES; KIAA1398; mKIAA1398; mRRp; mRRp0; mRRp1.8; mRRp10; mRRp15a; mRRp15b; mRRp16.8; mRRp2; mRRp41; mRRp47; mRRp5.4; p180; ribosome binding protein 1; ribosome binding protein 1 homolog 180 kDa (dog); ribosome receptor protein; Ribosome-binding protein 1; RP11-462D18.3; Rrbp1; RRp | |
RRBP1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RRBP1 (aa 1055-1178) Control Fragment | |
RUO | |
RRBP1 | |
Unconjugated | |
Recombinant | |
QLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.