Learn More
Invitrogen™ Human RRAS2 (aa 130-174) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP103087
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62274 (PA5-62274. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
RRAS2 is involved in activating mutations and the overexpression of classical Ras subfamily members (K-RAS, N-RAS and H-RAS) have been widely investigated as key events in the development of human cancers. The RRAS subfamily of Ras-related proteins includes RRAS1, RRAS2 (TC21) and RRAS3 (M-Ras) show overall amino acid identity with the classical Ras subfamily (H-Ras, K-Ras and N-Ras) of 55-60%. RRAS2 is a small GTP binding protein of the Ras superfamily of GTPases. It might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins. RRAS2 has high oncogenic potential and overexpression/mutations have been reported in several tumor tissues and cell lines.
Especificaciones
P62070 | |
Blocking Assay, Control | |
22800 | |
100 μL | |
2610016H24Rik; C86394; Ras-like protein TC21; ras-related protein R-Ras2; related RAS viral (r-ras) oncogene homolog 2; Rras2; TC21; Teratocarcinoma oncogene | |
RRAS2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RRAS2 (aa 130-174) Control Fragment | |
RUO | |
RRAS2 | |
Unconjugated | |
Recombinant | |
DLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.