Learn More
Invitrogen™ Human RBMS3 (aa 340-418) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP96348
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57028 (PA5-57028. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Especificaciones
Q6XE24 | |
Blocking Assay, Control | |
27303 | |
100 μL | |
6720477E09Rik; 8430436O14Rik; RBMS3; RNA binding motif single stranded interacting protein 3; RNA binding motif, single stranded interacting protein; RNA binding motif, single stranded interacting protein 3; RNA-binding motif, single-stranded-interacting protein 3; RNA-binding protein; RNA-binding protein RBMS3 | |
RBMS3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RBMS3 (aa 340-418) Control Fragment | |
RUO | |
RBMS3 | |
Unconjugated | |
Recombinant | |
MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.