Learn More
Invitrogen™ Human RBM6 (aa 246-336) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP95087
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55530 (PA5-55530. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DEF-3 and LUCA15 belong to an evolutionarily conserved family of RNA binding proteins and share similar expression patterns. Both DEF-3 and LUCA15 are highly expressed in adult heart and thymus as well as fetal kidney. Conversely, fetal thymus and adult kidney express very little DEF-3 and LUCA15. In the haemopoietic system of mice, the expression of DEF-3 is downregulated upon differentiation of progenitor cells into granulocytes but persists during macrophage development. Both DEF-3 and LUCA15 contain two zinc finger motifs, a bipartite nuclear signal and two RNA binding motifs. DEF-3 and LUCA15 are capable of specifically binding poly(G) RNA.
Especificaciones
P78332 | |
Blocking Assay, Control | |
10180 | |
100 μL | |
3G2; 4930506F14Rik; DEF3; DEF-3; ETK2; g16; HEK2; HLC-11; Lung cancer antigen NY-LU-12; lung cancer protooncogene 11; mKIAA4015; NY-LU-12; Protein G16; Rbm6; RGD1560367; RNA binding motif protein 6; RNA-binding motif protein 6; RNA-binding protein 6; RNA-binding protein DEF-3; TYRO6 | |
RBM6 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RBM6 (aa 246-336) Control Fragment | |
RUO | |
RBM6 | |
Unconjugated | |
Recombinant | |
DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.