missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RACK1 (aa 153-232) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP92500
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82771 (PA5-82771. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
RACK1 (receptor for activated C kinase 1) was identified through its binding to various PKC isoforms. Its main function is to recruit PKC and various other proteins to specific locations to form multiprotein complexes, mediating various signal pathways. RACK1 is required for VANGL2 membrane localization and for PTK2/FAK1 phosphorylation and dephosphorylation.
Especificaciones
| P63244 | |
| Blocking Assay, Control | |
| 10399 | |
| 100 μL | |
| 12-3; activated protein kinase C receptor; AL033335; Cell proliferation-inducing gene 21 protein; CG7111; CG7111-PA; CG7111-PB; CG7111-PC; CG7111-PD; Dmel\CG7111; Dmel_CG7111; dRack1; GB-like; gnb2l1; Gnb2-rs1; guanine nucleotide binding protein (G protein) beta polypeptide 2-like 1; guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1; guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1 sequence 1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; guanine nucleotide binding protein beta polypeptide 2-like 1; guanine nucleotide binding protein related; guanine nucleotide binding protein, beta 2, related sequence 1; guanine nucleotide binding protein, beta polypeptide 2-like 1; guanine nucleotide binding protein, beta-2, related sequence 1; guanine nucleotide-binding protein beta-subunit like protein; guanine nucleotide-binding protein subunit beta-2-like 1; Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed; Guanine nucleotide-binding protein subunit beta-like protein; Guanine nucleotide-binding protein subunit beta-like protein 12.3; H12.3; HLC7; HLC-7; Human lung cancer oncogene 7 protein; i173; lung cancer oncogene 7; OTTHUMP00000223870; OTTHUMP00000223891; OTTHUMP00000223893; OTTHUMP00000223900; OTTHUMP00000223901; OTTHUMP00000223902; OTTHUMP00000223930; OTTHUMP00000223931; p205; PIG21; proliferation-inducing gene 21; protein homologous to chicken B complex protein, guanine nucleotide binding; protein kinase C receptor; RACK; Rack1; rack-1; Rack1-PA; Rack1-PB; Rack1-PC; Rack1-PD; RE74715p; receptor for activated C kinase; receptor for activated C kinase 1; receptor for activated protein kinase C; receptor for activated protein kinase C1; receptor of activated PKC; receptor of activated protein C kinase 1; Receptor of activated protein C kinase 1, N-terminally processed; Receptor of activated protein kinase C; receptor of activated protein kinase C 1; Receptor of activated protein kinase C homolog; similar to mammalian RACK1; Small ribosomal subunit protein RACK1; wu:fb80d08; wu:fk65d12 | |
| RACK1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RACK1 (aa 153-232) Control Fragment | |
| RUO | |
| RACK1 | |
| Unconjugated | |
| Recombinant | |
| CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human RACK1 (aa 153-232) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido