Learn More
Invitrogen™ Human PTPRK (aa 794-852) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101384
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63026 (PA5-63026. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Protein tyrosine phosphatases, or PTPs, are type I transmembrane proteins, membrane associated proteins or proteins localized in nuclei. Examples of transmembrane PTPs are LAR, PTP alpha, PTP beta, PTP gamma, PTP delta, PTP epsilon, PTP zeta, PTPk and PTP-mu. Transmembrane PTPs play diverse roles during development and in adult tissues. Immunodepletion studies have suggested LAR to be a regulator of Insulin receptor phosphorylation. PTP alpha activity is increased twofold in response to phorbol ester stimulation, resulting in serine phosphorylation either directly or indirectly by members of the PKC family. Overexpression of v-H-ras and Neu, but not Myc or Int2, in mammary tumors has been shown to induce PTP epsilon expression. An alternative splicing event leads to a nervous tissue-specific chondroitin sulfate proteoglycan called phosphacan, which represents the amino terminal portion of PTP zeta. PTPk and PTP-mu share a conserved amino terminal 160 amino acid MAM domain which facilitates homophilic binding. PTP-mu localizes to points of cell contact and may be involved in regulating the assembly and disassembly of cadherin/catenin complexes in vivo.
Especificaciones
Q15262 | |
Blocking Assay, Control | |
5796 | |
100 μL | |
AI853699; dJ480J14.2.1 (protein tyrosine phosphatase, receptor type, K (R-PTP-KAPPA, protein tyrosine phosphatase kappa , protein tyrosine phosphatase kappa; protein tyrosine phosphatase, receptor type K; protein tyrosine phosphatase, receptor type, K; protein tyrosine phosphatase, receptor type, K, extracellular region; protein-tyrosine phosphatase kappa; protein-tyrosine phosphatase, receptor type, kappa; Ptpk; PTPRK; receptor-like protein tyrosine phosphatase kappa extracellular region (RPTPK); receptor-type tyrosine-protein phosphatase kappa; Rptpk; R-PTPk; R-PTP-k; RPTPkappa; R-PTP-kappa | |
PTPRK | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PTPRK (aa 794-852) Control Fragment | |
RUO | |
PTPRK | |
Unconjugated | |
Recombinant | |
MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.