Learn More
Abnova™ Human PTBP1 Partial ORF (NP_002810, 45 a.a. - 144 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]
Especificaciones
Especificaciones
Número de acceso | NP_002810 |
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 5725 |
Peso molecular | 36.74kDa |
Nombre | PTBP1 (Human) Recombinant Protein (Q01) |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cantidad | 25 ug |
Inmunógeno | KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ |
Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.