missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human PRAS40 (aa 182-255) Control Fragment Recombinant Protein Código de producto.: 30210834

Invitrogen™ Human PRAS40 (aa 182-255) Control Fragment Recombinant Protein

Código de producto. 30210834
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30210834

Marca: Invitrogen™ RP106048

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111183 (PA5-111183. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Akt signaling pathway contributes to the regulation of apoptosis after a variety of cell death signals. AKT1S1, also known as PRAS40, is a proline-rich substrate of the kinase AKT1 and is thought to play a role in neuroprotection mediated by nerve growth factor (NGF) after transient focal cerebral ischemia. AKT1S1 is also a substrate and potential regulator of mammalian target of rapamycin (mTOR), a serine/threonine kinase that regulates cell growth and cell cycle, and a negative regulator of autophagy. Treatment with the insulin-like growth factor-1 (IGF1) can induce the phosphorylation of AKT1S1 via the PI3K/AKT signaling pathway in PC12 cells.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96B36
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 84335
Nombre Human PRAS40 (aa 182-255) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1110012J22Rik; 40 kDa proline-rich AKT substrate; AI227026; AKT1 substrate 1; AKT1 substrate 1 (proline rich); AKT1 substrate 1 (proline-rich); akt1s1; Lobe; Lobel; OTTHUMP00000196756; OTTHUMP00000196760; PKB/Akt substrate 40; Pras; PRAS40; Proline-rich AKT substrate; proline-rich AKT1 substrate 1
Nombre común PRAS40
Símbolo de gen AKT1S1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human PRAS40 (aa 182-255) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado