Learn More
Invitrogen™ Human PPP1R3A (aa 954-1069) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109209
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139975 (PA5-139975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PPP1R3A, the glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37-kD catalytic subunit and a 124-kD targeting and regulatory subunit. PPP1R3A encodes the regulatory subunit which binds to muscle glycogen with high affinity, thereby enhancing dephosphorylation of glycogen-bound substrates for PP1 such as glycogen synthase and glycogen phosphorylase kinase.
Especificaciones
Q16821 | |
Blocking Assay, Control | |
5506 | |
100 μL | |
glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle; glycogen-associated regulatory subunit of protein phosphatase-1; GM; PP1G; PPP1R3; PPP1R3A; protein phosphatase 1 glycogen- associated regulatory subunit; protein phosphatase 1 glycogen-associated regulatory subunit; Protein phosphatase 1 regulatory subunit 3 A; protein phosphatase 1 regulatory subunit GM; protein phosphatase 1, regulatory (inhibitor) subunit 3 A; protein phosphatase 1, regulatory subunit 3 A; protein phosphatase type-1 glycogen targeting subunit; RG1; serine /threonine specific protein phosphatase; type-1 protein phosphatase skeletal muscle glycogen targeting subunit | |
PPP1R3A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PPP1R3A (aa 954-1069) Control Fragment | |
RUO | |
PPP1R3A | |
Unconjugated | |
Recombinant | |
CNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.