Learn More
Abnova™ Human PPP1CA Partial ORF (NP_002699, 224 a.a. - 330 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Especificaciones
Especificaciones
Número de acceso | NP_002699 |
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 5499 |
Peso molecular | 37.51kDa |
Nombre | PPP1CA (Human) Recombinant Protein (Q01) |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cantidad | 25 ug |
Inmunógeno | SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.