Learn More
Invitrogen™ Human PPM1B (aa 359-463) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP91561
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82557 (PA5-82557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences.
Especificaciones
O75688 | |
Blocking Assay, Control | |
5495 | |
100 μL | |
EGK_05287; Pp2c2; PP2CB; PP2CBETA; PP2C-beta; PP2C-beta-X; PPC2BETAX; PPM1B; Pppm1b; Protein phosphatase 1 B; protein phosphatase 1 B (formerly 2 C), magnesium-dependent, beta isoform; protein phosphatase 1 B, magnesium dependent, beta isoform; protein phosphatase 2 C isoform beta; protein phosphatase 2 C-like protein; Protein phosphatase type 1 B (formely 2 C) Mg-dependent beta isoform; Protein phosphatase type 1 B (formely 2 C), Mg-dependent, beta isoform; protein phosphatase, Mg2+/Mn2+ dependent 1 B; protein phosphatase, Mg2+/Mn2+ dependent, 1 B; Ser/Thr protein phosphatase type 2 C beta 2 isoform | |
PPM1B | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PPM1B (aa 359-463) Control Fragment | |
RUO | |
PPM1B | |
Unconjugated | |
Recombinant | |
KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.