missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PP11 (aa 20-111) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP105427
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66924 (PA5-66924. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein with protease activity and is expressed in the placenta. The protein may be useful as a tumor marker. Multiple alternatively spliced transcript variants have been found for this protein.
Especificaciones
| P21128 | |
| Blocking Assay, Control | |
| 8909 | |
| 100 μL | |
| 22 serine protease; 26 serine protease; endonuclease, poly(U) specific; endonuclease, poly(U)-specific; endonuclease, polyU-specific; ENDOU; P11; placental protein 11; placental protein 11 related; placental protein 11-related protein; Poly(U)-specific endoribonuclease; PP11; Pp11r; PP11-related protein; Protein endoU; PRSS26; T-cell-specific protein 30; Tcl-30; Uridylate-specific endoribonuclease | |
| ENDOU | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PP11 (aa 20-111) Control Fragment | |
| RUO | |
| PP11 | |
| Unconjugated | |
| Recombinant | |
| KIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human PP11 (aa 20-111) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido