Learn More
Invitrogen™ Human PON2 (aa 149-262) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP93674
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83070 (PA5-83070. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded protein may also play a role in defense responses to pathogenic bacteria. Mutations in this gene may be associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively spliced transcript variants encoding different isoforms have been described.
Especificaciones
Q15165 | |
Blocking Assay, Control | |
5445 | |
100 μL | |
6330405I24Rik; A esterase 2; A-esterase 2; AI481612; aromatic esterase 2; arylesterase 2; paraoxonase 2; paraoxonase nirs; PON 2; PON2; Serum aryldialkylphosphatase 2; serum paraoxonase/arylesterase 2 | |
PON2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PON2 (aa 149-262) Control Fragment | |
RUO | |
PON2 | |
Unconjugated | |
Recombinant | |
ENSLLHLKTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSANGINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.