missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human POLR1E (aa 200-300) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106393
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111351 (PA5-111351. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors (PubMed:24207024). Appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF (PubMed:24207024). [UniProt]
Especificaciones
| Q9GZS1 | |
| Blocking Assay, Control | |
| 64425 | |
| 100 μL | |
| 53 kDa; AU042259; D030019D19Rik; DNA-directed RNA polymerase I subunit E; DNA-directed RNA polymerase I subunit RPA49; FLJ13390; FLJ13970; hypothetical protein LOC511587; Paf53; Polr1e; polymerase (RNA) I associated factor 1; polymerase (RNA) I polypeptide E; polymerase (RNA) I polypeptide E, 53 kDa; polymerase (RNA) I subunit E; PRAF1; RGD1565773; RNA polymerase I associated factor (Paf53); RNA polymerase I associated factor 53; RNA polymerase I subunit A49; RNA polymerase I subunit E; RNA polymerase I-associated factor 1; RNA polymerase I-associated factor 53; RP11-405L18.3 | |
| Polr1e | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human POLR1E (aa 200-300) Control Fragment | |
| RUO | |
| POLR1E | |
| Unconjugated | |
| Recombinant | |
| LPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human POLR1E (aa 200-300) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido