Learn More
Invitrogen™ Human POLN (aa 421-510) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP105911
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65162 (PA5-65162. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a DNA polymerase type-A family member. The encoded protein plays a role in DNA repair and homologous recombination. This gene shares its 5' exons with some transcripts from overlapping GeneID: 79441, which encodes an augmentin-like protein complex subunit. [provided by RefSeq, Dec 2014].
Especificaciones
Q7Z5Q5 | |
Blocking Assay, Control | |
353497 | |
100 μL | |
DNA polymerase N; DNA polymerase nu; DNA polymerase POL4P; DNA-directed DNA polymerase nu; POL4P; POLN; polymerase (DNA directed) nu; polymerase (DNA) nu | |
POLN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human POLN (aa 421-510) Control Fragment | |
RUO | |
POLN | |
Unconjugated | |
Recombinant | |
WQLFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLGARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLHLLSQRNSLPRTGLQK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.