Learn More
Invitrogen™ Human PKC beta (aa 606-670) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP103020
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83906 (PA5-83906. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Especificaciones
P05771 | |
Blocking Assay, Control | |
5579 | |
100 μL | |
A130082F03Rik; PKCB; PKC-B; PKC-beta; PRKCB; PRKCB1; PRKCB2; protein kinase C beta; protein kinase C beta I; protein kinase C beta II; protein kinase C beta type; protein kinase C beta-II; protein kinase C, beta; protein kinase C, beta 1; protein kinase C, beta 1 polypeptide | |
PRKCB | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PKC beta (aa 606-670) Control Fragment | |
RUO | |
PKC beta | |
Unconjugated | |
Recombinant | |
EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVIN | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.