missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PKC beta (aa 606-670) Control Fragment Recombinant Protein

Recombinant Protein

Marca:  Invitrogen™ RP103020

Código de producto. 30195736

  • 271.00€ / 100 microlitros

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Explore más ofertas especiales
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Descripción

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83906 (PA5-83906. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
TRUSTED_SUSTAINABILITY
Especificaciones

Especificaciones

P05771
Blocking Assay, Control
5579
100 μL
A130082F03Rik; PKCB; PKC-B; PKC-beta; PRKCB; PRKCB1; PRKCB2; protein kinase C beta; protein kinase C beta I; protein kinase C beta II; protein kinase C beta type; protein kinase C beta-II; protein kinase C, beta; protein kinase C, beta 1; protein kinase C, beta 1 polypeptide
PRKCB
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human PKC beta (aa 606-670) Control Fragment
RUO
PKC beta
Unconjugated
Recombinant
EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVIN
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human PKC beta (aa 606-670) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado