missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human PDIR (aa 126-216) Control Fragment Recombinant Protein Código de producto.: 30205764

Invitrogen™ Human PDIR (aa 126-216) Control Fragment Recombinant Protein

Código de producto. 30205764
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30205764

Marca: Invitrogen™ RP95564

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDIR (protein disulfide isomerase-related protein) is a novel PDI protein that was originally isolated from a human placental cDNA library. It has been suggested that from its nucleotide sequence, PDIR has three CXXC-like motifs (Cys-Ser-Met-Cys, Cys-Gly-His-Cys and Cys-Pro-His-Cys), which are found in the PDI superfamily of proteins. The CXXC motif is responsible for oxidoreductase activity. PDIR is also shown to have a putative endoplasmic reticulum (ER) retention signal 'Lys-Glu-Glu-Leu' at its carboxyl terminus, indicative of ER resident proteins. Northern blot analysis of PDIR indicates that it is preferentially expressed in cells actively secreting proteins. It has also been shown that expression of PDIR is stress-inducible. Data suggest that PDIR, like other PDIs, has oxidoreductase activity of disulfide bonds and facilitates the protein folding process within the lumen of the ER.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q14554
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10954
Nombre Human PDIR (aa 126-216) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2700053F16Rik; AU015525; Pdia5; PDIR; protein disulfide isomerase A5; protein disulfide isomerase associated 5; protein disulfide isomerase family A member 5; protein disulfide isomerase family A, member 5; protein disulfide isomerase-associated 5; protein disulfide isomerase-related protein; Protein disulfide-isomerase A5
Nombre común PDIR
Símbolo de gen PDIA5
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia VTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human PDIR (aa 126-216) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado