missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PCDH11Y Partial ORF (NP_004733, 57 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00083259-Q01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 7 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The gene is located in a major X/Y block of homology and its most closely related cadherin superfamily member is located in this homologous region on the X chromosome. The protein is thought to play a fundamental role in cell-cell recognition essential for the segmental development and function of the central nervous system. Transcripts arising from alternative splicing encode isoforms with N- and C-terminal variation. [provided by RefSeq]
Sequence: EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINEspecificaciones
| NP_004733 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.73kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN | |
| RUO | |
| PCDH11Y | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 83259 | |
| PCDH11Y (Human) Recombinant Protein (Q01) | |
| 25 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PCDH-PC/PCDH11X/PCDH22/PCDHY | |
| PCDH11Y | |
| Recombinant | |
| wheat germ expression system |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human PCDH11Y Partial ORF (NP_004733, 57 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal > 25μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido