Learn More
Invitrogen™ Human PARP14 (aa 1521-1641) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89867
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82454 (PA5-82454. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Poly [ADP-ribose] polymerase 14 (PARP14) is a B aggressive lymphoma protein belonging to the PARP protein family. Poly ADP ribosylation is a DNA damage dependent post translational modification of histones and other nuclear proteins that mediates DNA repair. PARP proteins with a macrodomain are also involved in gene expression through transcriptional regulation. PARP14 controls STAT6 dependent transcription by enhancing binding to the promoter in the presence of a positive signal (i.e. IL4 stimulation).
Especificaciones
Q460N5 | |
Blocking Assay, Control | |
54625 | |
100 μL | |
1600029O10Rik; ADP-ribosyltransferase diphtheria toxin-like 8; ARTD8; B aggressive lymphoma protein 2; B-aggressive lymphoma 2; BAL2; BC021340; CoaSt6; Collaborator of STAT6; KIAA1268; mKIAA1268; Parp14; PARP-14; pART8; poly (ADP-ribose) polymerase family, member 14; poly [ADP-ribose] polymerase 14; poly(ADP-ribose) polymerase family member 14; Protein mono-ADP-ribosyltransferase PARP14; protein mono-ADP-ribosyltransferase PARP14; poly [ADP-ribose] polymerase 14; RGD1310490; Unknown (protein for IMAGE:8227979) | |
PARP14 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PARP14 (aa 1521-1641) Control Fragment | |
RUO | |
PARP14 | |
Unconjugated | |
Recombinant | |
AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.