Learn More
Abnova™ Human OSCAR Partial ORF (NP_996553.1, 175 a.a. - 254 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Especificaciones
Especificaciones
| Número de acceso | NP_996553.1 |
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 126014 |
| Peso molecular | 34.54kDa |
| Nombre | OSCAR (Human) Recombinant Protein (Q01) |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Cantidad | 25 μg |
| Inmunógeno | TLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQP |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.