missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NTNG1 (aa 22-74) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107469
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66811 (PA5-66811. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Netrin G1 (NTNG1) belongs to a conserved family of proteins that act as axon guidance cues during vertebrate nervous system development (Nakashiba et al., 2000).
Especificaciones
| Q9Y2I2 | |
| Blocking Assay, Control | |
| 22854 | |
| 100 μL | |
| A930010C08Rik; AI853992; axon guidance molecule; Kiaa0976; laminet 1; laminet-1; LMNT1; netrin G1; netrin G1f; netrin-G1; Ntng1; RGD1563465; UNQ571/PRO1133; YLSR571 | |
| NTNG1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NTNG1 (aa 22-74) Control Fragment | |
| RUO | |
| NTNG1 | |
| Unconjugated | |
| Recombinant | |
| PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human NTNG1 (aa 22-74) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido