missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NPHP3 (aa 256-360) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89775
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52656 (PA5-52656. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Required for normal ciliary development and function. Inhibits disheveled-1-induced canonical Wnt-signaling activity and may also play a role in the control of non-canonical Wnt signaling which regulates planar cell polarity. Probably acts as a molecular switch between different Wnt signaling pathways. Required for proper convergent extension cell movements.
Especificaciones
| Q7Z494 | |
| Blocking Assay, Control | |
| 27031 | |
| 100 μL | |
| 3632410F03Rik; AI550417; C230078J01; CFAP31; cilia and flagella associated protein 31; D330020E01Rik; Kiaa2000; Meckel syndrome, type 7; MKS7; Nephrocystin-3; nephronophthisis 3 (adolescent); NPH3; NPHP3; pcy; RHPD; RHPD1; SLSN3 | |
| NPHP3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NPHP3 (aa 256-360) Control Fragment | |
| RUO | |
| NPHP3 | |
| Unconjugated | |
| Recombinant | |
| PEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human NPHP3 (aa 256-360) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido