Learn More
Invitrogen™ Human NPAT (aa 1027-1107) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107495
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66839 (PA5-66839. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Required for progression through the G1 and S phases of the cell cycle and for S phase entry. Activates transcription of the histone H2A, histone H2B, histone H3 and histone H4 genes in conjunction with MIZF. Also positively regulates the ATM, MIZF and PRKDC promoters. Transcriptional activation may be accomplished at least in part by the recruitment of the NuA4 histone acetyltransferase (HAT) complex to target gene promoters.
Especificaciones
Q14207 | |
Blocking Assay, Control | |
4863 | |
100 μL | |
CAND3; E14; E14/NPAT; NPAT; Nuclear protein of the ataxia telangiectasia mutated locus; nuclear protein of the ATM locus; nuclear protein, ataxia-telangiectasia locus; nuclear protein, coactivator of histone transcription; nuclear protein, co-activator of histone transcription; p220; Protein NPAT | |
NPAT | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human NPAT (aa 1027-1107) Control Fragment | |
RUO | |
NPAT | |
Unconjugated | |
Recombinant | |
VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.