Learn More
Invitrogen™ Human NIP7 (aa 90-180) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP104724
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65279 (PA5-65279. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
Especificaciones
Q9Y221 | |
Blocking Assay, Control | |
51388 | |
100 μL | |
1110017C15Rik; 60 S ribosome subunit biogenesis protein NIP7 homolog; 60 S ribosome subunit biogenesis protein NIP-like protein-like protein; 6330509M23Rik; AA408773; AA410017; CGI-37; FLJ10296; HSPC031; HSPC180; hypothetical protein LOC553616; KD93; kDa93; Nip7; NIP7 nucleolar pre-rRNA processing protein; NIP7, nucleolar pre-rRNA processing protein; Nip7p; nuclear import 7; nuclear import 7 homolog; nuclear import 7 homolog (S. cerevisiae); nucleolar pre-rRNA processing protein NIP7; OK/SW-cl0.76; OK/SW-cl0.78; pEachy; PUA protein; Saccharomyces cerevisiae Nip7p homolog; zgc:110384 | |
Nip7 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human NIP7 (aa 90-180) Control Fragment | |
RUO | |
NIP7 | |
Unconjugated | |
Recombinant | |
APYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.