Learn More
Invitrogen™ Human Neurofascin (aa 541-666) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89922
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52615 (PA5-52615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Neurofascin encodes an L1 family immunoglobulin cell adhesion molecule with multiple IGcam and fibronectin domains. The protein functions in neurite outgrowth, neurite fasciculation, and organization of the axon initial segment (AIS) and nodes of Ranvier on axons during early development. Both the AIS and nodes of Ranvier contain high densities of voltage-gated Na+ (Nav) channels which are clustered by interactions with cytoskeletal and scaffolding proteins including this protein, gliomedin, ankyrin 3 (ankyrin-G), and betaIV spectrin. This protein links the AIS extracellular matrix to the intracellular cytoskeleton. Neurofascin undergoes extensive alternative splicing, and the full-length nature of some variants has not been determined.
Especificaciones
O94856 | |
Blocking Assay, Control | |
23114 | |
100 μL | |
AA387016; D430023G06Rik; DKFZp686P2250; KIAA0756; KIAA0756FLJ46866; mKIAA0756; neurofascin; neurofascin homolog; NF; Nfasc; NRCAML | |
NFASC | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Neurofascin (aa 541-666) Control Fragment | |
RUO | |
Neurofascin | |
Unconjugated | |
Recombinant | |
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.