Learn More
Invitrogen™ Human Nardilysin (aa 1068-1138) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP104972
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65810 (PA5-65810. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.
Especificaciones
O43847 | |
Blocking Assay, Control | |
4898 | |
100 μL | |
2600011I06Rik; AI875733; hNRD1; hNRD2; nardilysin; nardilysin (N-arginine dibasic convertase); nardilysin 1; nardilysin 1 (N-arginine dibasic convertase); nardilysin convertase; nardilysin, N-arginine dibasic convertase 1; nardilysin, N-arginine dibasic convertase, NRD convertase 1; N-arginine dibasic convertase; N-arginine dibasic convertase 1; NRD convertase; Nrd1; NRDC; NRD-C | |
Nrdc | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Nardilysin (aa 1068-1138) Control Fragment | |
RUO | |
Nardilysin | |
Unconjugated | |
Recombinant | |
LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.