Learn More
Invitrogen™ Human MZF1 (aa 583-723) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP100724
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51630 (PA5-51630. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Binds to target promoter DNA and functions as transcription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development. [UniProt]
Especificaciones
P28698 | |
Blocking Assay, Control | |
7593 | |
100 μL | |
myeloid zinc finger 1; Myeloid zinc finger protein 1; Myeloid zinc finger protein 2; myeloid-specific retinoic acid-responsive zinc finger protein; MZF; MZF1; MZF-1; MZF1B; Mzf2; Mzf-2; Zfp121; Zfp98; Zinc finger and SCAN domain-containing protein 6; zinc finger protein 121; Zinc finger protein 42; zinc finger protein 42 (myeloid-specific retinoic acid-responsive); zinc finger protein 98; Znf42; ZSCAN6 | |
MZF1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MZF1 (aa 583-723) Control Fragment | |
RUO | |
MZF1 | |
Unconjugated | |
Recombinant | |
TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.