Learn More
Abnova™ Human MYC Partial ORF (NP_002458, 330 a.a. - 439 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. [provided by RefSeq]
Especificaciones
Especificaciones
Número de acceso | NP_002458 |
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 4609 |
Peso molecular | 37.84kDa |
Nombre | MYC (Human) Recombinant Protein (Q01) |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cantidad | 10 ug |
Inmunógeno | VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA |
Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.