Learn More
Invitrogen™ Human MTHFR (aa 423-497) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109540
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140282 (PA5-140282. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine. Genetic variation in this gene influences susceptibility to occlusive vascular disease, neural tube defects, colon cancer and acute leukemia, and mutations in this gene are associated with methylenetetrahydrofolate reductase deficiency.
Especificaciones
P42898 | |
Blocking Assay, Control | |
4524 | |
100 μL | |
5,10-methylenetetrahydrofolate reductase; 5,10-methylenetetrahydrofolate reductase (NADPH); AI323986; Methylenetetrahydrofolate reductase; methylenetetrahydrofolate reductase (NAD(P)H); MTHFR; RP11-56N19.4 | |
MTHFR | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MTHFR (aa 423-497) Control Fragment | |
RUO | |
MTHFR | |
Unconjugated | |
Recombinant | |
EELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.