missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MSI1 (aa 217-274) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107335
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Musashi-1 belongs to the Musashi family of RNA-binding proteins which play a role in cell fate determination, and maintenance of stem-cell state. Musashi family proteins are also involved in post transcriptional gene regulation. The gene encodes a protein with two conserved tandem RNA recognition motifs with highly conserved RNP (ribonucleoprotein) motifs. In mammals, Musashi-1 is expressed in fetal kidney, brain, liver and lung, and in adult brain and pancreas. In humans, the gene is located on chromosome 12.
Especificaciones
| O43347 | |
| Blocking Assay, Control | |
| 4440 | |
| 100 μL | |
| fb40b12; hypothetical protein LOC541389; m-Msi-1; ms1; msi1; msi1b; Msi1h; Musahi1; musashi homolog 1; Musashi homolog 1(Drosophila); musashi RNA binding protein 1; musashi RNA binding protein 1 b; musashi RNA-binding protein 1; musashi1; musashi-1; RNA-binding protein Musashi homolog 1; RNA-binding protein Musashi homolog 1 L+35 bp; RNA-binding protein Musashi homolog 1 Long; RNA-binding protein Musashi homolog 1 b; wu:fb40b12; zgc:103751; zMsi1 | |
| MSI1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MSI1 (aa 217-274) Control Fragment | |
| RUO | |
| MSI1 | |
| Unconjugated | |
| Recombinant | |
| LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human MSI1 (aa 217-274) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido