Learn More
Invitrogen™ Human MRPS7 (aa 82-161) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP93247
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54594 (PA5-54594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p.
Especificaciones
Q9Y2R9 | |
Blocking Assay, Control | |
51081 | |
100 μL | |
28 S ribosomal protein S7, mitochondrial; 30 S ribosomal protein S7 homolog; bMRP27a; bMRP-27 A; mitchondrial ribosomal protein S7; mitochondrial ribosomal protein S7; Mitochondrial small ribosomal subunit protein uS7m; MRP-S; Mrps7; MRP-S7; ribosomal protein, mitochondrial, S7; Rpms7; RP-S7; S7mt | |
MRPS7 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MRPS7 (aa 82-161) Control Fragment | |
RUO | |
MRPS7 | |
Unconjugated | |
Recombinant | |
TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.