Learn More
Invitrogen™ Human MRP4 (aa 1176-1317) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101757
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82019 (PA5-82019. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies. This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in cellular detoxification as a pump for its substrate, organic anions. Alternative splicing results in multiple splice variants encoding different isoforms.
Especificaciones
O15439 | |
Blocking Assay, Control | |
10257 | |
100 μL | |
ABCC4; ABC-tranporter; ATP binding cassette subfamily C member 4; ATP-binding cassette protein C4; ATP-binding cassette sub-family C member 4; ATP-binding cassette, subfamily C (CFTR/MRP), member 4; ATP-binding cassette, sub-family C (CFTR/MRP), member 4; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); canalicular multispecific organic anion transporter (ABC superfamily); D630049P08Rik; EST170205; MOATB; MOAT-B; MRP/cMOAT-related ABC transporter; MRP4; Multidrug resistance-associated protein 4; multi-specific organic anion transporter B; RP11-74A12.1 | |
ABCC4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MRP4 (aa 1176-1317) Control Fragment | |
RUO | |
MRP4 | |
Unconjugated | |
Recombinant | |
NFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPST | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.