Learn More
Invitrogen™ Human MRGPRX2 (aa 299-328) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101544
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca(2+) but had no effect on basal or forskolin-stimulated cAMP levels, suggesting that this receptor is G(q)-coupled. Has a limited expression profile, both peripheral and within the central nervous system, with highest levels in dorsal root ganglion.
Especificaciones
Q96LB1 | |
Blocking Assay, Control | |
117194 | |
100 μL | |
G protein-coupled receptor MRGX2; G370024M05Rik; MAS related GPR family member X2; Mas-related G protein-coupled receptor G3; MAS-related GPR, member B10; MAS-related GPR, member X2; mas-related G-protein coupled receptor member B10; Mas-related G-protein coupled receptor member X2; MGRG3; MrgB10; Mrgprb10; Mrgprx2; MRGX2 | |
MRGPRX2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MRGPRX2 (aa 299-328) Control Fragment | |
RUO | |
MRGPRX2 | |
Unconjugated | |
Recombinant | |
ALQRALQDIAEVDHSEGCFRQGTPEMSRSS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.