Learn More
Invitrogen™ Human MRAP (aa 1-37) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90458
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52775 (PA5-52775. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
MRAP encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2.
Especificaciones
Q8TCY5 | |
Blocking Assay, Control | |
56246 | |
100 μL | |
1110025G12Rik; B27; C21orf61; Falp; Fat cell-specific low molecular weight protein; fat tissue-specific low MW protein; FGD2; GCCD2; melanocortin 2 receptor accessory protein; melanocortin-2 receptor accessory protein; Mrap; ORF61 | |
Mrap | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MRAP (aa 1-37) Control Fragment | |
RUO | |
MRAP | |
Unconjugated | |
Recombinant | |
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.