missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human MLH3 (aa 1341-1426) Control Fragment Recombinant Protein Código de producto.: 30198605
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30198605

Invitrogen™ Human MLH3 (aa 1341-1426) Control Fragment Recombinant Protein

Código de producto. 30198605
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198605

Marca: Invitrogen™ RP107020

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66338 (PA5-66338. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. The protein encoded by this gene functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UHC1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 27030
Nombre Human MLH3 (aa 1341-1426) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AV125803; BB126472; CAE; CAE1; cell surface glycoprotein; connexin 50; connexin-50; CTRCT1; C x 50; CZP1; DNA mismatch repair protein Mlh3; gap junction alpha 8; gap junction alpha-8 protein; gap junction membrane channel protein alpha-8; gap junction protein alpha 8; gap junction protein alpha 8 50 kDa; GJA8; HNPCC7; lens fiber protein MP70; lens intrinsic membrane protein MP70; MGC138372; MLH3; MP70; mutL homolog 3; mutL homolog 3 (E coli); MutL protein homolog 3
Nombre común MLH3
Símbolo de gen MLH3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRLIEALSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLTKLRKMA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human MLH3 (aa 1341-1426) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado